SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B7BQW6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B7BQW6
Domain Number 1 Region: 77-167
Classification Level Classification E-value
Superfamily PH domain-like 8.96e-27
Family Third domain of FERM 0.0000274
Further Details:      
 
Domain Number 2 Region: 2-76
Classification Level Classification E-value
Superfamily Second domain of FERM 3.66e-19
Family Second domain of FERM 0.0000946
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B7BQW6
Sequence length 316
Comment (tr|A0A0B7BQW6|A0A0B7BQW6_9EUPU) Uncharacterized protein {ECO:0000313|EMBL:CEK94545.1} OX=1028688 OS=Arion vulgaris. GN=ORF201374 OC=Stylommatophora; Sigmurethra; Arionoidea; Arionidae; Arion.
Sequence
KAIQFGGLQCQVQFGDHVDSKHKPGFLDLKEFLPKEYIKLKGIEKKIFGEHQKFVGLSEV
EAKVKYTQFCRSLKTYGITFFLVKEKMKGKNKLVPRLLGITKESVVRVDEKTKEIMKTWP
LTTVRRWAASPNSFTLDFGDYSDTYYSVQTTEGEQISQLIAGYIDIILRKKKAKDHLGIE
GDENSTMYEENVQAGQATIIQHNMGNIKHPSSGNVSMPGLLRDGYQGENKISVGSLHGQV
SSQSNQGKTIQTKELTQAQRAFIVTITEGLDAIDTAQDNLNRSQICLVLAMIQPLRNGER
ISWTCPDKKWGPSYRP
Download sequence
Identical sequences A0A0B7BQW6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]