SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B7DEZ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B7DEZ3
Domain Number 1 Region: 3-72
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 3.53e-29
Family Ribosomal L11/L12e N-terminal domain 0.0000362
Further Details:      
 
Domain Number 2 Region: 68-141
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 4.45e-23
Family Ribosomal protein L11, C-terminal domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B7DEZ3
Sequence length 143
Comment (tr|A0A0B7DEZ3|A0A0B7DEZ3_PSEFL) 50S ribosomal protein L11 {ECO:0000256|HAMAP-Rule:MF_00736, ECO:0000256|SAAS:SAAS00731162} KW=Complete proteome OX=294 OS=Pseudomonas fluorescens. GN=SRM1_05190 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MAKKITAYIKLQVKAAQANPSPPVGPALGQHGVNIMEFCKAFNARTQGIEAGLPTPVIIT
VYSDRSFTFETKSTPASVLLKKAAGLTSGSARPNTVKVGTVTRAQLEEIAKTKNADLTAA
DMDAAVRTIAGSARSMGLNVEGV
Download sequence
Identical sequences A0A0B7DEZ3 A0A2G6UV12
WP_042561349.1.27757 WP_042561349.1.64306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]