SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0B7KEG6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B7KEG6
Domain Number 1 Region: 361-563
Classification Level Classification E-value
Superfamily MIR domain 2.75e-57
Family MIR domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B7KEG6
Sequence length 968
Comment (tr|A0A0B7KEG6|A0A0B7KEG6_BIOOC) Uncharacterized protein {ECO:0000313|EMBL:CEO53290.1} OX=29856 OS=Bionectria ochroleuca (Gliocladium roseum). GN=BN869_000009348_1 OC=Clonostachys.
Sequence
MGKSNGARGRSPQPPSEKQQQPAAAAQLQPALAVPGAPKARSKSRSKSRSKNKKKAVNAI
STSYKSDGVEDNDVFLLPVSDYVVALGIIALATLVRTWKIYMPTSVVFDEVHFGGFASKY
IKGKFFMDVHPPLAKMLIALTGWLAGFDGSFDFKEIGKDYIEPNVPYVAMRMFPAICGIL
LAPIMFLTLKTVGCRTVTALLGSSFIIFENGLLTQARLILLDSPLVFATGYTALAFNAFT
NQHELGPSKAFSPSWWFWLINTGLGLGITASIKWVGLFTIAWVGLLTILQLWILLGDVQN
VSMRLWTKHLMARVFSLIIVPLTFYMAMFAIHFLCLVNPGEGDGFMSSEFQSTLNSKGMA
SVPADVVMGSKVSIRHVNTQGGYLHSHPLMYPTGSKQQQITLYPHKDENNLWFLENQTQP
LGADGQPINGTNAWDLLPEPSHITDGAVLRLYHVNTHRRLHSHDVRPPVTEADWQNEVSA
YGYEGFEGDANDFFRVEIVKKQSKSGAAQQRLRTIETKFRLVHVMTGCVLFSHKVKLPDW
ASEQQEVTCARGGSVPNSVWYIESNESPHLGADAERVNYNKPGFFSKFAEIHAVMWRTNA
GLTDSHAWDSRPESWPILRRGINFWGRNNTQVYLLGNPIIWWSSSISIVVWVIFKVIAVI
RWQRSCGDYSNATFKRFDYEIGTSILGWALHYFPFYLMKRQLFLHHYFPALYFAIIALCQ
VIDFATSRIPASHGHASSGVIFNRITAVVFLVLSGAAFSLLSPLAYGGPWTKAQCNRVKL
FPTWDFDCKNFHDSLDQYTYLTVEAGTNPTPTPSVAEAVVPENEAQKPLGDAPEAKAPEA
KAPVEEVKVVAAEEQVVEYRDQNGNLLNEEQVKSLREQSAEFSTKLETETQVVDDVAKEQ
PQSVESEAPVVAPPHPDVEGLNSETVKSDEKVEIPQDAAASRDGEKEAEQKQAKPASEGQ
EATVNQEL
Download sequence
Identical sequences A0A0B7KEG6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]