SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B8NTQ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B8NTQ5
Domain Number 1 Region: 83-137
Classification Level Classification E-value
Superfamily Chondroitin AC/alginate lyase 0.000000522
Family Hyaluronate lyase-like catalytic, N-terminal domain 0.098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B8NTQ5
Sequence length 157
Comment (tr|A0A0B8NTQ5|A0A0B8NTQ5_9VIBR) Uncharacterized protein {ECO:0000313|EMBL:GAM55682.1} KW=Complete proteome; Reference proteome OX=1481914 OS=Vibrio ishigakensis. GN=JCM19231_746 OC=Vibrionaceae; Vibrio.
Sequence
MLQFSEQEISAIKQRATQSTIQALIDNNHVVLNTDTLVPPDGRATWNLYYFCPEHGVRLT
WDRDKPTSHVCPVDGKEFTGEPYDGAWWRWLNGLNAKACYDLGLLWHLTGDDRYLEKVTD
ILMQSAKYYPDYEVHGGIPYNGPGKANAQTCVKQTAT
Download sequence
Identical sequences A0A0B8NTQ5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]