SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0B8YBC8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B8YBC8
Domain Number 1 Region: 4-184
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 4.71e-47
Family Methylesterase CheB, C-terminal domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B8YBC8
Sequence length 187
Comment (tr|A0A0B8YBC8|A0A0B8YBC8_9SPHI) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome; Reference proteome OX=1122941 OS=Pedobacter glucosidilyticus. GN=PBAC_33110 OC=Sphingobacteriaceae; Pedobacter.
Sequence
MDTIFLIGGSAGSLKVLLEVLPKLHHDLKFPIIIVLHRKGYTDSQLGYLLSTRTNLKVIE
PDDKDVLEAGYIYIAPADYHLLIESDKTISLDFSEKLNFSRPSIDVTFSSAAKVFKENTF
ALLLSGANADGAAGLNYVKANNGTTLVQNPVSAEVNYMPLQAIAQSKIDFVLNPDEIAAF
INKLDVP
Download sequence
Identical sequences A0A0B8YBC8
WP_039455089.1.44706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]