SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C1D8L0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C1D8L0
Domain Number 1 Region: 19-192
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 2.01e-33
Family Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase (MurB), N-terminal domain 0.00034
Further Details:      
 
Domain Number 2 Region: 218-357
Classification Level Classification E-value
Superfamily Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain 2.75e-32
Family Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C1D8L0
Sequence length 359
Comment (tr|A0A0C1D8L0|A0A0C1D8L0_9NOCA) UDP-N-acetylmuramate dehydrogenase {ECO:0000256|HAMAP-Rule:MF_00037} KW=Complete proteome OX=1141657 OS=Nocardia vulneris. GN=FG87_11725 OC=Bacteria; Actinobacteria; Corynebacteriales; Nocardiaceae; Nocardia.
Sequence
MVPSDVLAATGARIRAGVPLAELTTLRVGGPATVAECRSTDVLVATVRALDAAGVPVLLL
AGGSNLLISDAGFDGVVVRVATDGVELGADGVVAEAGANWDAVVAATVAAGLGGLECLSG
IPGSAGATPVQNVGAYGAEVAQLLRRVQLLDRASGAIRWAAPGELGFGYRTSVLKHRDDA
VVLAVDFALDPKGMSAPLRYGELATRLGAADGESRPAAEVRDAVLGLRAGKGMVLDPADH
DTWSAGSFFTNPVVAADRVPAVRAAIAAHVGEVTVPTYPAPDGVKFSAGWLIERAGFAKG
FPGSGAPARLSTKHTLALTNRGAATATDLVELARTVRDGVAERFGIRLEPEPVTVGLAL
Download sequence
Identical sequences A0A0C1D8L0
WP_052280462.1.45561 WP_052280462.1.60884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]