SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0C1GKL0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C1GKL0
Domain Number 1 Region: 713-913
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.27e-25
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.024
Further Details:      
 
Domain Number 2 Region: 18-212
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.0000000000000253
Family Pyruvate oxidase and decarboxylase Pyr module 0.032
Further Details:      
 
Domain Number 3 Region: 434-619
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.000000000000377
Family PFOR PP module 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C1GKL0
Sequence length 1139
Comment (tr|A0A0C1GKL0|A0A0C1GKL0_9RHOB) Indolepyruvate ferredoxin oxidoreductase {ECO:0000313|EMBL:KIC42631.1} KW=Complete proteome; Reference proteome OX=1577903 OS=Ruegeria sp. ANG-R. GN=RA27_04575 OC=Rhodobacteraceae; Ruegeria.
Sequence
MSQPKITLNDRFDLSKSPVLLNGTQALVRLMLMQKERDRAAGLNTAGLVTGYRGSPLGAV
DLQMSRAEKQLAASDVTFQYGLNEDLAATALWGSQQAGLRGDGKFDGVFGLWYGKGPGVD
RSGDVMRHANMAGTAQHGGVLMAMGDDHTGESSTVLHQSEWSLVDMYMPVVSPAGVQEIL
DYGIYGFALSRFAGVWVGLKTMKDTIEVTSVVDGRPDRMPVKIPMFDMPKGGLNIRLGDT
PHLQEARVIDYKRFAAETFSHANKLDKRIWGKPGAKIGFVAAGKNWLDLAHAMSLLNIDA
GEAERLGITTYKIGQTFPLDMKGFHDWAEGLDLIVIVEEKRKLIEVQVKEAIFDDRRGRR
VYGWYKGGAGTLHREELFPTRGALDPIMIAEKLGQILIEEGHDTDGVRAGLARLDEARRA
DNAQEIAARLPYFCSGCPHNSSTKLPDGSRAYAGIGCHYMVQWMDRETTGFTQMGGEGAN
WVGEAPFSTTKHVFQNLGDGTYNHSGVQAIRAALAAGTNITFKILFNDAVAMTGGQENEG
GLSAERIVAEVKAMGVRDVAVVYDEKEDVNFGAMPADIETFERADLMRVQEKFRDIEGVS
VIVYIQTCAAEKRRRRKRGSFPDPDKRVFINTDICEGCGDCGVQSNCVSIVPKETELGRK
RAIDQSSCNKDFSCLNGFCPSFITVEGAQVRKEATTDIDLPDLPEPDLPQIDGTHNVVIT
GVGGTGVVTIGAVLAQAAQIDGKGAGMMEMAGLAQKGGAVHINCRIANKPEDISAIRVAT
GEAHALIGGDLVVSAGAKTLGLTRAGQTGAVVNSHEIVTGDFTRDTDFQIPSDRLELALR
ARLKDAVDLFDATDLARAVMGDSIYSNMMVFGATWQRGLLPIRHQAIMEAIELNGAAVER
NKRAFEVGRWAVTHPEEVAKILHLNVAELPKTLDQVIDFRAAHLTDYQGKRLAKRYRKLV
DGVEDNKVREAVAKGYHKLLSYKDEYEVARLLLDSRQKAAAEFDGDFRMTFHLAPPALGS
KGVNGRPTKKAFGEWFLGPLKLLAKLKVLRGTPLDVFGYTAERKMERALIRQYEKDMKEV
LPKLTSETSQAIAALAALPLGIRGFGPVLVANEAKAAKRREELLAVIRDGGPEMKAAAE
Download sequence
Identical sequences A0A0C1GKL0
WP_039535362.1.91690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]