SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0C1J8B3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C1J8B3
Domain Number 1 Region: 713-913
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 5.89e-23
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.027
Further Details:      
 
Domain Number 2 Region: 17-205
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.00000000000000424
Family Pyruvate oxidase and decarboxylase Pyr module 0.036
Further Details:      
 
Domain Number 3 Region: 434-619
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.000000000000659
Family Pyruvate oxidase and decarboxylase PP module 0.055
Further Details:      
 
Domain Number 4 Region: 264-351
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000408
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C1J8B3
Sequence length 1139
Comment (tr|A0A0C1J8B3|A0A0C1J8B3_9RHOB) Indolepyruvate ferredoxin oxidoreductase {ECO:0000313|EMBL:KIC44320.1} KW=Complete proteome; Reference proteome OX=1577904 OS=Ruegeria sp. ANG-S4. GN=RA28_15355 OC=Rhodobacteraceae; Ruegeria.
Sequence
MSQPKVSLNDRFDLSKSPVLMNGTQALVRLMLMQKARDKNAGLNTAGLVTGYRGSPLGAV
DQQMTRAQKQLTESDVTFQFGLNEDLAATALWGSQQAGLRGDGKYDGVFGLWYGKGPGVD
RSGDVMRHANMAGTAKHGGVLMAMGDDHTGESSTVLHQSEWSLVDMYMPVVSPAGVQEIL
DYGVYGFALSRFAGVWVGLKTMKDTIEVTSVVDGSIDRMNVVTPEFDMPEGGLNIRLGDT
PHLQEARVIDYKRFAAETFSHANKLDKRVWGKPGAKIGIVAAGKNWLDLVHAMSLLNIDT
DEAERLGITTYKVGQTFPLDMKGFHDWAEGLDLIVIVEEKRKLIEVQVKEAIFDDRRGRR
VYGWYKGGAGTLHREELFPTRGALDPIMIAEKLGGILIEEGRDTDGVRAGLEALTEARRA
DNAQEIAARLPYFCSGCPHNSSTKLPEGSRAYAGIGCHYMVQWMDRETTGFTQMGGEGAN
WIGEAPFSTTEHVFQNLGDGTYNHSGVQAIRAALAAGTNMTFKILFNDAVAMTGGQDNDG
DLTAERIVDEVKAMGVQKVALVYDEKEDVNLKALPAGVETHERAELNSVQEKFREIKGVS
VIVYVQTCAAEKRRRRKRGTFPDPDKRVYINPDICEGCGDCGVQSNCVSIVPKETELGRK
RAIDQSSCNKDFSCLNGFCPSFVTLEGAQIRKEATTEVDLPDLPDPDLPEINGTHNVVIT
GVGGTGVVTIGAVLAQAAQVDGKGAGMMEMAGLAQKGGAVHIHCRLANAPEDISAIRVAT
GEAHALIGGDLVVSAGAKTLGLTQTGQTGAVVNNHEIVTGDFTRDTEFRIPGDQLELALQ
ARLKNRLDLFDASALARAVMGDSIYSNMMVFGAAWQRGLIPIRHSAIQQAIGLNGTAVER
NKRAFEVGRWAVLHPEAVDGILGQNVTELPKTLDQIIAFRADHLVAYQGKGLAKRYRKLV
DAIEDEEVREAVAKGYHKLLSYKDEYEVARLLLQTRDKAAAEFDSDFKMTFHLAPPAIGG
KETNGRPPKRAFSERFLGLFRLLARLKSLRGTPLDIFGYTAERKMERALIKQYEKDMNEV
LPKVSAETRDAVAALARLPLDIRGFGPVLKANEAKAAKRREELLAVIRDGGPDIRAAAE
Download sequence
Identical sequences A0A0C1J8B3
WP_039530502.1.83325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]