SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C1KJH2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C1KJH2
Domain Number 1 Region: 90-161
Classification Level Classification E-value
Superfamily YajQ-like 9.94e-30
Family YajQ-like 0.00013
Further Details:      
 
Domain Number 2 Region: 2-87
Classification Level Classification E-value
Superfamily YajQ-like 3.4e-27
Family YajQ-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C1KJH2
Sequence length 161
Comment (tr|A0A0C1KJH2|A0A0C1KJH2_9PSED) UPF0234 protein RR51_06505 {ECO:0000256|HAMAP-Rule:MF_00632} KW=Complete proteome OX=1586081 OS=Pseudomonas sp. C5pp. GN=RR51_06505 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MPSFDVVSELDKHEVQNAVDNAIKDLDRRYDLKGKGTFEFKDKEQTVMLTAEEEFQLEAM
LEILRLALVKRKIDVKCLETKDPYASGKEKKQEAKFREGIDKDLAKKIVATIKDAKLKVQ
AAIQGEQVRVTGKKRDDLQEAIALLRTKEFDMPLQFNNFRD
Download sequence
Identical sequences A0A059V2G5 A0A099N3N1 A0A0C1KJH2 A0A0E9ZMP0 A0A0M2UDF4 A0A136QIP5 A0A1L5PVS1 F8G565 L0FR80 V7D4S9 V9V2P0
WP_013974099.1.15314 WP_013974099.1.23948 WP_013974099.1.28354 WP_013974099.1.33515 WP_013974099.1.35335 WP_013974099.1.35716 WP_013974099.1.36363 WP_013974099.1.42658 WP_013974099.1.56258 WP_013974099.1.57632 WP_013974099.1.59340 WP_013974099.1.65173 WP_013974099.1.65739 WP_013974099.1.71677 WP_013974099.1.7288 WP_013974099.1.7435 WP_013974099.1.78427 WP_013974099.1.80759 WP_013974099.1.98117 gi|568189232|ref|YP_008961911.1| gi|431804296|ref|YP_007231199.1| gi|568183859|ref|YP_008956548.1| gi|339489226|ref|YP_004703754.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]