SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0C1KKQ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C1KKQ2
Domain Number 1 Region: 150-335
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 6.02e-61
Family Methylesterase CheB, C-terminal domain 0.0000254
Further Details:      
 
Domain Number 2 Region: 1-104
Classification Level Classification E-value
Superfamily CheY-like 2.85e-21
Family CheY-related 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C1KKQ2
Sequence length 337
Comment (tr|A0A0C1KKQ2|A0A0C1KKQ2_9PSED) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome OX=1586081 OS=Pseudomonas sp. C5pp. GN=RR51_05185 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MKIAIVNDMPMAVEALRRAVALEPAHQVVWVASNGAEAVQRCTEQQPDLILMDLIMPVMD
GVEATRRIMAETPCAIVIVTVDRKQNVHRVFEAMGHGALDVVDTPALGAGDPREAAAPLL
RKILNISWLIGQQRAPAARPVAAPVRAASQHRGLVAIGSSAGGPAALEVLLKGLPAAFPA
AIVLVQHVDQVFAAGMAEWLSSAAGLPVRLAREGEPPQPGQVLLAGTNHHIRLLQNGQLA
YTAEPVNEIYRPSIDVFFESVARYWTGDAVGVLLTGMGRDGAQGLKLMRQQGFLTIAQDQ
ASSAVYGMPKAAAAIDAAVEIRPLERIAGRLMEFFAK
Download sequence
Identical sequences A0A059UTT7 A0A099MWJ8 A0A0C1KKQ2 A0A136QL31 F8FZV4 L0FHE1
gi|431801110|ref|YP_007228013.1| WP_013971215.1.1643 WP_013971215.1.23948 WP_013971215.1.35335 WP_013971215.1.56258 WP_013971215.1.65739 WP_013971215.1.71677 WP_013971215.1.7288 WP_013971215.1.7435 WP_013971215.1.80759 WP_013971215.1.95946 gi|339486071|ref|YP_004700599.1| 2035999819 gi|568180621|ref|YP_008953146.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]