SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C1MKZ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C1MKZ0
Domain Number 1 Region: 42-135
Classification Level Classification E-value
Superfamily FlaG-like 6.67e-20
Family FlaG-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C1MKZ0
Sequence length 136
Comment (tr|A0A0C1MKZ0|A0A0C1MKZ0_9GAMM) FlaG protein {ECO:0000313|EMBL:KID57729.1} KW=Complete proteome OX=43657 OS=Pseudoalteromonas luteoviolacea. GN=JF50_11230 OC=Pseudoalteromonadaceae; Pseudoalteromonas.
Sequence
MKDVQSAVGVGSNGMVPTPDKLKPEEGSETLRAVEDTSKLELSREKKEDGSQVQPELFEE
VKANLDRLNNVLPVTSTNLSFEFDENGDPPFIRVIDRDSEEVIREIPSEEFREVAKALDE
FADKVSGKGLLFDRTA
Download sequence
Identical sequences A0A0C1MKZ0 A0A167LRQ1
WP_039609496.1.52665 WP_039609496.1.94671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]