SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C1QAH0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C1QAH0
Domain Number 1 Region: 4-95
Classification Level Classification E-value
Superfamily DnaK suppressor protein DksA, alpha-hairpin domain 2.62e-23
Family DnaK suppressor protein DksA, alpha-hairpin domain 0.0011
Further Details:      
 
Domain Number 2 Region: 96-133
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000428
Family Prokaryotic DksA/TraR C4-type zinc finger 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C1QAH0
Sequence length 136
Comment (tr|A0A0C1QAH0|A0A0C1QAH0_9GAMM) Molecular chaperone DnaK {ECO:0000313|EMBL:KID57616.1} KW=Complete proteome OX=43657 OS=Pseudoalteromonas luteoviolacea. GN=JF50_10610 OC=Pseudoalteromonadaceae; Pseudoalteromonas.
Sequence
MTSAIEQKIIDAPESDYMNDEQLAFFKDLLIELHDTTRARIKEAKEEMLNPPDLPDFNDR
ASWEEQCELLMRIVDREQKLLPKIQLSLERIRLGTYGYCLETGEPIGVQRLMARPTAEYC
IDVKACQEMKEHLIRS
Download sequence
Identical sequences A0A0C1QAH0 A0A162B230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]