SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0C1R2E6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C1R2E6
Domain Number 1 Region: 4-175
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 6.02e-41
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C1R2E6
Sequence length 176
Comment (tr|A0A0C1R2E6|A0A0C1R2E6_9CLOT) Pyruvate ferredoxin/flavodoxin oxidoreductase family protein {ECO:0000313|EMBL:KIE44631.1} KW=Complete proteome; Reference proteome OX=1418104 OS=Clostridium argentinense CDC 2741. GN=U732_242 OC=Clostridium.
Sequence
MASQEVIFAGFGGQGILSMGKFLAYAGMDANKNVSWLPSYGPEMRGGTANCSVIVTDDQV
GSPIVTKPTSVVVMNRPSLDKFEKTLVKGGLLIIDSNLVDREIERTDIEVIRIPAQDEAA
KVGSGQIANMVLLGALVAKTQIVSMDELLEALKAHGKEKFFEINRKALEIGASYTK
Download sequence
Identical sequences A0A0C1R2E6
WP_039635980.1.22478 WP_039635980.1.91264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]