SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C1U258 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C1U258
Domain Number 1 Region: 8-129
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 0.0000337
Family Family 1 bi-partite nucleotidyltransferase subunit 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C1U258
Sequence length 137
Comment (tr|A0A0C1U258|A0A0C1U258_9CLOT) Uncharacterized protein {ECO:0000313|EMBL:KIE45613.1} KW=Complete proteome; Reference proteome OX=1418104 OS=Clostridium argentinense CDC 2741. GN=U732_2710 OC=Clostridium.
Sequence
MVRREIVIFRIDKLKEYLRYLEDVKKYSREEYIKNPLIYGSSERFLHLTIECVMDIANHL
ISDLRFRKPESNRDVFDILYENDIIDRKLKESLCNMASFRNILVHDYLKLDREIVYDIIL
NNLGDIVSFLNIIKDYI
Download sequence
Identical sequences A0A0C1U258
WP_039635319.1.22478 WP_039635319.1.91264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]