SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C1UW71 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C1UW71
Domain Number 1 Region: 2-123
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 1.28e-26
Family N-terminal domain of MutM-like DNA repair proteins 0.00025
Further Details:      
 
Domain Number 2 Region: 135-224
Classification Level Classification E-value
Superfamily S13-like H2TH domain 1.19e-22
Family Middle domain of MutM-like DNA repair proteins 0.0007
Further Details:      
 
Domain Number 3 Region: 221-271
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000162
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C1UW71
Sequence length 273
Comment (tr|A0A0C1UW71|A0A0C1UW71_9ACTN) Formamidopyrimidine-DNA glycosylase {ECO:0000256|SAAS:SAAS00635501} KW=Complete proteome; Reference proteome OX=1550399 OS=marine actinobacterium MedAcidi-G1. GN=MB52_02270 OC=Bacteria; Actinobacteria.
Sequence
MPELPEVESIRSQLEPLITGKTILNGYSFPSKKFLQAKLSSGFLVRDVNRRGKYLIINLE
KESGRKINLKELIVHLGMTGSLSVVEEKSDDPYIRAEWELNDGQILLFRDIRRFGRIAVV
DPGDYKSLPTLDNIGPEPFDPKLSAESFYASLSSSRSCIKTKLLSQRIVAGLGNIYVDES
LWRSRINPVARRIGKERSETLLISIREVLSQAIDNGGTTFRDYRTPDGLTGKNQHNLDCY
GRAGKACRNCSHVLKNRIIGQRSTTWCPQCQIS
Download sequence
Identical sequences A0A0C1UW71 A0A2E1CEU4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]