SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C1VA28 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C1VA28
Domain Number 1 Region: 4-134
Classification Level Classification E-value
Superfamily Transthyretin (synonym: prealbumin) 8.24e-28
Family Transthyretin (synonym: prealbumin) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C1VA28
Sequence length 134
Comment (tr|A0A0C1VA28|A0A0C1VA28_9ACTN) 5-hydroxyisourate hydrolase {ECO:0000256|RuleBase:RU361270} KW=Complete proteome; Reference proteome OX=1571774 OS=Streptomyces sp. RSD-27. GN=PL81_36355 OC=Streptomyces.
Sequence
MSTETTASVSTHILDTSIGRPAEGVAISLSARAGLAGEWAALGGSATDADGRCKDLPALP
EGTTHVRLDFETETYFLNKHSAKKQAEAQQDAPRVRDSGAFFPEVTITFAVNPGEHYHVP
LLLNPFGYSVYRGS
Download sequence
Identical sequences A0A0C1VA28

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]