SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C1XL64 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C1XL64
Domain Number 1 Region: 19-148
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 0.000000837
Family MJ1460-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C1XL64
Sequence length 153
Comment (tr|A0A0C1XL64|A0A0C1XL64_9CYAN) Hydrocarbon-binding protein {ECO:0000313|EMBL:KIF32694.1} KW=Complete proteome; Reference proteome OX=1304833 OS=Hassallia byssoidea VB512170. GN=PI95_31255 OC=Bacteria; Cyanobacteria; Nostocales; Tolypothrichaceae; Hassallia.
Sequence
MSRPILGDFSSIVCFKSAIVGMEDALGEKAIAIALISAGRRRGKHLAQELGLAGANLSLD
DIASKLGFAFGKDGTRLCIINRIKAEGDVIKVYTSETLCSTGEPQGSDRKCTYTLGAVWG
ALQQTFGKRFQGKHTESVLRGGEYDVFEFTEMN
Download sequence
Identical sequences A0A0C1XL64

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]