SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C1YK79 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C1YK79
Domain Number 1 Region: 1-236
Classification Level Classification E-value
Superfamily ThiG-like 3.01e-84
Family ThiG-like 0.000000613
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C1YK79
Sequence length 255
Comment (tr|A0A0C1YK79|A0A0C1YK79_9VIBR) Thiazole synthase {ECO:0000256|HAMAP-Rule:MF_00443, ECO:0000256|SAAS:SAAS00958550} KW=Complete proteome OX=1344582 OS=Vibrio owensii 47666-1. GN=M445_26395 OC=Vibrionaceae; Vibrio.
Sequence
MLKIGDKQFESRLFTGTGKFANSRLMAEAIQVSGSQLATMALKRVDVNDQQDDILLPLVQ
AGVNLLPNTSGAKNAKDAVFAAQLAREALGTNWLKLEIHPDPKYLMPDPIETLVAAEQLV
REGFIVLPYCHADPVLCKRLEEVGCAAVMPLGAPIGSNKGIVSHDFLEIIIDQANVPVVV
DAGIGAPSHAARAMEMGADAVLVNTAIAASSDPVAMAKAFKLAVESGRMAYEAGLAGKVS
HAVASSPLTSFLDEL
Download sequence
Identical sequences A0A0C1YK79
WP_039843035.1.26610 WP_039843035.1.70465 WP_039843035.1.90381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]