SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0C1Z1Y8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C1Z1Y8
Domain Number 1 Region: 3-186
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 3.79e-47
Family Methylesterase CheB, C-terminal domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C1Z1Y8
Sequence length 328
Comment (tr|A0A0C1Z1Y8|A0A0C1Z1Y8_9BURK) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome; Reference proteome OX=870478 OS=Burkholderia sp. MR1. GN=BurMR1_1695 OC=Burkholderiaceae; Burkholderia.
Sequence
MDHRDIVVIAASRGAIPVLKRLVSALPRDFPAAIFIVLHVGRHKSVLPDMLSQWGALPAR
HPASGEALARHEVYVAPPDRHMVLLHGEICLLDTAAENFARPAADPLFRSAAMEYGPRVV
GVVLSGDLDDGAAGLAAVRARGGYCVVQDPLDCEAPSMPRSALAATSADAVVSADRLAHA
IDAAVKGARRSEEATVSIRPDLDQEAQIGNRGVVTPEELDRIGERSALTCPNCSGALWRM
RDERPLRFRCHTGHAFTSLSLEEGNEKRTEDAIWSAIRAVHERIILAQQRRRWAEHAGST
DDIAIEQTRIEENEKLVELLRAAIGATS
Download sequence
Identical sequences A0A0C1Z1Y8
WP_040048498.1.46133 WP_040048498.1.63173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]