SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C2DXU5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C2DXU5
Domain Number 1 Region: 63-135
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 3.14e-22
Family Ribosomal protein L11, C-terminal domain 0.00017
Further Details:      
 
Domain Number 2 Region: 4-66
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 4.97e-19
Family Ribosomal L11/L12e N-terminal domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C2DXU5
Sequence length 144
Comment (tr|A0A0C2DXU5|A0A0C2DXU5_9MOLU) 50S ribosomal protein L11 {ECO:0000256|HAMAP-Rule:MF_00736} KW=Complete proteome; Reference proteome OX=2138 OS=Spiroplasma poulsonii. GN=SMSRO_v1c22100 OC=Spiroplasmataceae; Spiroplasma.
Sequence
MARITRIAKLEFQAGQAKPGPELASLGINMPQFCTQFNDATKDRMGDVVPVVITAFDDKS
FKFELKTTPAAILLKKAAKIQKGSAKAKDEIVATISADEVRKIAEYKLVDLNANDVEAAM
HIIEGTARNMGIVVDGMPSKKEKN
Download sequence
Identical sequences A0A0C2DXU5
WP_040094610.1.59675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]