SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0C2GJN4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C2GJN4
Domain Number 1 Region: 13-289
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 6.28e-88
Family Capz beta-1 subunit 0.0000000074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C2GJN4
Sequence length 294
Comment (tr|A0A0C2GJN4|A0A0C2GJN4_9BILA) F-actin capping protein, beta subunit {ECO:0000313|EMBL:KIH61395.1} KW=Complete proteome; Reference proteome OX=51022 OS=Ancylostoma duodenale. GN=ANCDUO_08335 OC=Ancylostoma.
Sequence
MLPNDPHLILMHSEQQLDCALDLMRRLPPQQCEKNLIDLIDLCPGLCDDLLAFHENPVSS
AKSTVDQPLKVAKDRETGKEYLLCDYSRDGDSYRSPWTNTYDPPTEDAQLPSEKLRKLEI
EANAAFESYRDMYFEGGISSVYFWDLDHGFAGVVLIKKTGDGSKAIQGCWDSIHVIEINE
RSSRQVHYKLTSTIMLWLQTNKPGSGMMNLGGSLTRQVEQDSPVNEQNPHLVNIGRMIED
QESKMRSTINEIYFGKTKKVIGDLRSVETPAEKEKQEEIVREIRTAVAGRNSAA
Download sequence
Identical sequences A0A0C2GJN4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]