SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0C2HRF2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C2HRF2
Domain Number 1 Region: 5-192
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 7.19e-43
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C2HRF2
Sequence length 192
Comment (tr|A0A0C2HRF2|A0A0C2HRF2_9DELT) Indolepyruvate oxidoreductase subunit beta {ECO:0000313|EMBL:KIH77445.1} KW=Complete proteome; Reference proteome OX=1121915 OS=Geoalkalibacter ferrihydriticus DSM 17813. GN=GFER_01570 OC=Geobacteraceae; Geoalkalibacter.
Sequence
MKNKVQNILLVGVGGQGILLASEILSEVLMLGGYDVKKAEVHGMAQRGGSVVSHVRYGEK
VYSPIIPEGEADILFGFELLESYRYLPLLKKDAQVVVSDLQIVPPGVALGKESYPEDVPG
KIRAAFPRSRIVNSMDLAVQAGNMRTVNTVLLGALSTMMDIAEDAWVQAMKNRVPARFLD
ENLKAFSLGRQA
Download sequence
Identical sequences A0A0C2HRF2 A0A1G9QUN6
WP_040095449.1.19427 WP_040095449.1.30025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]