SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0C2IKQ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C2IKQ8
Domain Number 1 Region: 334-538
Classification Level Classification E-value
Superfamily MIR domain 3.92e-56
Family MIR domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C2IKQ8
Sequence length 1000
Comment (tr|A0A0C2IKQ8|A0A0C2IKQ8_9PEZI) Dolichyl-phosphate-mannose-protein mannosyltransferase {ECO:0000313|EMBL:KIH87555.1} KW=Complete proteome OX=1398154 OS=Sporothrix brasiliensis 5110. GN=SPBR_04624 OC=Sporothrix.
Sequence
MGRSGAARSPSARASPPPSGKPKSKKDAAVIRPDDYSSDGVKDNDVFLLPGSDFQILIGV
TILAAIVRLFRIYQPTSVVFDEVHFGGFASKYIKGRFFMDVHPPLAKMLIALTGFLAGFD
GEFDFKEIGKDYLEPGVPYVAMRLFPAICGILLVPTMYLTLKAANCRTSTALMGAGLIIF
ENGLLTQARLILLDSPLIAATAFTALAFTAFSNQHEQGPSKAFTPSWWFWLFTTGLGLGI
TVSIKWVGLFTIAWVGSLTLIQLWVLLGDTKTVTVRVFSKHFMARVFCLIIVPATFYMGM
FGIHFLCLVNPGDGDGFMSSEFQATLNSKAMQDVPVDVLLGSSVTIRHVNTQGGYLHSHP
LMYPTGSKQQQVTLYPHKDHNNAWLLENQTQPLDSAGEPINGTDAWNKLPESGELPYIVD
GTVLRLFHPSTSRRLHSHDVRPPVTEADWQNEVSAYGYEGFDGDANDYFRVEIVKKQSDG
ALAKERVRTIETKFRLVHVMTGCVLFSHKVKLPDWASEQQEVTCARGGSLPNSVWYVESN
EHPLLGADAEKVNYRRPGFFGKFLELQQVMWKTNAGLVESHAYDSRPSAWPILRRGINFW
GKQHRQIYLIGNPFVWWSSTAAIVVYVLFKGIAVLRWQRSCGDYNNATFKRFDYEIGTSV
LGWAFHYFPFYLMERQLFLHHYFPALFFAIMAFCQVYDFATARFGVFRVKSNPLIGKAGA
MTILAVATVVFTLYAPLAYGNTWTKSECKRVQLFSSWDWDCNTFLDSYQEYEQFNMPSVA
AVPTSPGAAPVDEQPAPIADIPIAGGEHGQIPIEQAQQQQQQQQQQQPEEDKPQEVQQEQ
QQSVAEPEPLHTEPPAPPVALAQDGNQNQRILSRDERVEYRDQDGNILDPEQVEALRGKV
EFKTRYETRTRLVDEAGNEILDESAPVAPPHPDVEGVDQSTKQSLVADDALPQSADPSVE
GEREKDQTRAKPASEGSEATQRREAEEAEAAPAAAPAAEE
Download sequence
Identical sequences A0A0C2IKQ8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]