SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C2MEF1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C2MEF1
Domain Number 1 Region: 30-78
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.000000000131
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.0013
Further Details:      
 
Domain Number 2 Region: 78-127
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 0.00000000811
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C2MEF1
Sequence length 132
Comment (tr|A0A0C2MEF1|A0A0C2MEF1_THEKT) Transcription initiation factor IIA subunit 2 {ECO:0000256|PIRNR:PIRNR009415} KW=Complete proteome; Reference proteome OX=669202 OS=Thelohanellus kitauei (Myxosporean). GN=RF11_08960 OC=Platysporina; Myxobolidae; Thelohanellus.
Sequence
MEFSYPCANLFIMEPSKPTEGAEQKASMTQVYRVTTPGTTLQESLKEMIDSQQISPFLAT
DIMSIFDKTIVNVIENKCRNKIQIKGRIIDYRNCESLWTLMVKDANFKDFTSTKTVAYAK
IIAFDGKNSSNK
Download sequence
Identical sequences A0A0C2MEF1
KII62784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]