SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C2QXY6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C2QXY6
Domain Number 1 Region: 8-87
Classification Level Classification E-value
Superfamily Ada DNA repair protein, N-terminal domain (N-Ada 10) 9.55e-32
Family Ada DNA repair protein, N-terminal domain (N-Ada 10) 0.00019
Further Details:      
 
Domain Number 2 Region: 135-181
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000582
Family AraC type transcriptional activator 0.027
Further Details:      
 
Domain Number 3 Region: 82-133
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000717
Family AraC type transcriptional activator 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C2QXY6
Sequence length 188
Comment (tr|A0A0C2QXY6|A0A0C2QXY6_9BACL) AraC family transcriptional regulator {ECO:0000313|EMBL:KIL34134.1} KW=Complete proteome; Reference proteome OX=1590652 OS=Cohnella kolymensis. GN=SD71_20800 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Paenibacillaceae; Cohnella.
Sequence
MRGDFRMNDEQWQAIAGSDAAYDGHFYYGVVTTGIYCRPSCKSRIPVRDNVRIFSSFEQA
LAENFRPCKRCRPDGGRLPNEEWVAQISHVIETRYSEPFTLAKLAELFHGSPYHLQRTFK
QIKGMTPAEYIQQTRIERAKELLSSTDRTVMEVAVAVGIPNAAHFSTVFQQRTGVAPSNY
RIVVSGRE
Download sequence
Identical sequences A0A0C2QXY6
WP_041067701.1.17911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]