SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C2UGF4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C2UGF4
Domain Number 1 Region: 6-122
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 4.07e-43
Family DsrA/DsrB N-terminal-domain-like 0.0000957
Further Details:      
 
Domain Number 2 Region: 118-189,251-342
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.94e-33
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000153
Further Details:      
 
Domain Number 3 Region: 165-246
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.00000419
Family Ferredoxin domains from multidomain proteins 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C2UGF4
Sequence length 356
Comment (tr|A0A0C2UGF4|A0A0C2UGF4_MAGMG) Dissimilatory sulfite reductase beta subunit {ECO:0000313|EMBL:KIM00598.1} KW=Complete proteome OX=272627 OS=Magnetospirillum magnetotacticum MS-1. GN=CCC_03200 OC=Rhodospirillaceae; Magnetospirillum.
Sequence
MSELRRPVECGVPDSKQFMHPALVRNYGKWAFHDRPRPGVLRHVSDSGEAVFTVKAGTQR
QMDVHTIRKLCDIADTFCDGHVRFTVRSSVEFMTTDESKVEALVKRLEAEGFPVGGTGNS
VGFISHTQGWLHCDIPGTDASGVVKALMDELVHEFKSEEMPNRVKITTSCCQINCGGQGD
IAINVQHTKPPVINHALVAGVCERPAVIARCPVAAIRPALVDGKPSLEVDEKKCVCCGAC
YPPCPPMQINDPIHSKIAIWVGGKHSSTRSKPMFHKLVAAGLPNNAPRWPEVAEVVKKIL
AVYKADARAWERMGEWIERIGWPRFFELTELPFTKYHVDNWRGGRANLNASAHLHF
Download sequence
Identical sequences A0A0C2UGF4
WP_009867537.1.91102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]