SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0C2WYP1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C2WYP1
Domain Number 1 Region: 333-378
Classification Level Classification E-value
Superfamily MIR domain 7.46e-16
Family MIR domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C2WYP1
Sequence length 378
Comment (tr|A0A0C2WYP1|A0A0C2WYP1_9HOMO) Glycosyltransferase family 39 protein {ECO:0000313|EMBL:KIM22442.1} KW=Complete proteome; Reference proteome OX=933852 OS=Serendipita vermifera MAFF 305830. GN=M408DRAFT_79047 OC=Agaricomycetes; Sebacinales; Serendipitaceae; Serendipita.
Sequence
MGADEKLDAVRGGAPATRTFATPASRGTLGKIGSGEFKVLIAVVLVACAVRLFRLGKPNS
VVFDEVHFGKFAAKYIRTRYYVDVHPPLAKLLLTLASFVWGFDGSFEFKDIGAVYPSNVP
YVPMRFLPAILGVALVPITHLTLRELGCGASTALLGSVLVLFENGLVTQSRHILLDSPLL
FFTGLSTLFWVMFCNEDRKPVTKIPDAHTTRASHTITSGPFSRIWWIYLTLTGLALGAVV
SCKWVGLFTIATVGCSTIKQLWTLLGDTRVSPALWIRHFFARAVCLILVPLMFYMSMFKI
HFAILRNSGDGDAFMSSEFQHTLDGKEMRDTYADVAFNSVVTIRHVNTQGGYLHSHTHNY
PGGSKQQQITLYPHIDSN
Download sequence
Identical sequences A0A0C2WYP1
jgi|Sebve1|79047|e_gw1.79.81.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]