SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0C2Y0F4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C2Y0F4
Domain Number 1 Region: 9-284
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 5.36e-81
Family Capz alpha-1 subunit 0.00000185
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C2Y0F4
Sequence length 297
Comment (tr|A0A0C2Y0F4|A0A0C2Y0F4_HEBCY) Uncharacterized protein {ECO:0000313|EMBL:KIM43348.1} KW=Complete proteome; Reference proteome OX=686832 OS=Hebeloma cylindrosporum h7. GN=M413DRAFT_444180 OC=Hebeloma.
Sequence
MDDSSMEANDRIRAAANFLLQSPPGEINDVLNDIRNIISDDDLLQEGIQPALREYNIEQF
TVVDVPDTNHQSIISEAAREGDSLESEERFLDPRSKISFLFDHLSLEASDPVPFEPDETH
EPYRSALEAASLSYLKAHFTDGVTSVFSPKDGSSRYVIQIVANKYNPTNFWAGRWRSEYI
VDLTSNRVSGKMLINIHYYEQGNVQLATSHTVSFDIPPAVVSASPNTAASKILALIEGEE
GKYQISLSDTYQEMGEKTFKGLRRALPLTRQKLDWDKVMGYKLGAELSGSKPAFPNS
Download sequence
Identical sequences A0A0C2Y0F4
jgi|Hebcy2|444180|fgenesh1_kg.9_#_414_#_Locus3148v1rpkm21.35

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]