SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0C3AWL2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0C3AWL2
Domain Number - Region: 25-73
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0549
Family Capz alpha-1 subunit 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C3AWL2
Sequence length 109
Comment (tr|A0A0C3AWL2|A0A0C3AWL2_9HOMO) Uncharacterized protein {ECO:0000313|EMBL:KIM78403.1} KW=Complete proteome; Reference proteome OX=765440 OS=Piloderma croceum F 1598. GN=PILCRDRAFT_75512 OC=Agaricomycetes; Agaricomycetidae; Atheliales; Atheliaceae; Piloderma.
Sequence
ALDHLEGLIVARMFELTKMNMSQTGYKMRKHISKALQSHSQAIQSALERYNSAARLLPTP
RHQLDWKEVVEYVFLTDFNLLRDAHQDISNCPWATPAGRLAMDLYFKIA
Download sequence
Identical sequences A0A0C3AWL2
jgi|Pilcr1|75512|e_gw1.00047.223.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]