SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0C3B5E3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C3B5E3
Domain Number 1 Region: 242-620
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.18e-58
Family beta-glycanases 0.00059
Further Details:      
 
Weak hits

Sequence:  A0A0C3B5E3
Domain Number - Region: 604-697
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0732
Family Capz alpha-1 subunit 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C3B5E3
Sequence length 730
Comment (tr|A0A0C3B5E3|A0A0C3B5E3_9HOMO) Glycoside hydrolase family 51 protein {ECO:0000313|EMBL:KIM27414.1} KW=Complete proteome; Reference proteome OX=933852 OS=Serendipita vermifera MAFF 305830. GN=M408DRAFT_24624 OC=Agaricomycetes; Sebacinales; Serendipitaceae; Serendipita.
Sequence
MVYWTVITIIGGLLGFLSSALAQSATTTSSQVTSTVSTAPSLTATPIPSAITLKISTKSG
TRNKTAPLLHGLFFEDINNSGDGGLYGELIRNRAFQGSDPSDGTPQGAVPWGPTLKAWKS
IGSAVLSLDILNPLSDSLRTVLKVDIPANATGEVGFLNEGFWGMDVKPQAYGASFYVKPN
GALYKRNVTGVNLSIRSALTDDIWATTRVDISHNISVTKYTKLEAVLTPEAAAPNSNNTF
AITFDAAEAQGQTFYFDLISLFPPTFKGRKNGLRKDLAEHLMDIRPKFLRFPGGNNLEGI
SIDTRWQWKKNIGPLTDRPGRPGNWGYFNSDGLGYLEFLEWCEDMEMEPLLTVYAGYSID
LSGNQPAHTVPDDELQFYIDEAIEQLEYAMGGPDTKWGSLRAQHGHPEPFSIKFVEIGNE
DWFSDSYYWRYPRFLAALKAAYPNITYIASQATESSPANRNVTIPPGGMWDLHHYQTPQF
FKDNFNLFDNWQEVAGYPDVQIFVGEYSVLGRDRVGGIDWANGEGRFKYPTTIAAIGEAI
FALAMERNPRVVTLSSYAPLLQNFNRAQWTPNFIAFTADPSQTVLSTSYYMQKMFSHHKG
TETLPVSNTHGGLNPVWWHASIDTGSATRIGDADVDSTRFVQGNIYVKLVNAAKQPAPIT
LNFDTAVTKGNGTILHHEDEFGFNYRNNATAITTKMFDIEQSAIGNRGATVKYEIPGLSV
VVLELKQRGN
Download sequence
Identical sequences A0A0C3B5E3
jgi|Sebve1|24624|gm1.5896_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]