SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0C3CHA7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0C3CHA7
Domain Number - Region: 15-49
Classification Level Classification E-value
Superfamily MIR domain 0.022
Family MIR domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C3CHA7
Sequence length 61
Comment (tr|A0A0C3CHA7|A0A0C3CHA7_HEBCY) Uncharacterized protein {ECO:0000313|EMBL:KIM43544.1} KW=Complete proteome; Reference proteome OX=686832 OS=Hebeloma cylindrosporum h7. GN=M413DRAFT_443473 OC=Hebeloma.
Sequence
MDGLVSCQLSAPRDHAEVGFLRCDDRVSLVDEGQRNLLCSHGHASSESSYFEEPPFFTEV
L
Download sequence
Identical sequences A0A0C3CHA7
jgi|Hebcy2|443473|fgenesh1_kg.8_#_114_#_Locus22236v1rpkm0.46

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]