SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C3DC55 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0C3DC55
Domain Number - Region: 9-45
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00022
Family B-box zinc-binding domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C3DC55
Sequence length 71
Comment (tr|A0A0C3DC55|A0A0C3DC55_9HOMO) Uncharacterized protein {ECO:0000313|EMBL:KIM58300.1} KW=Complete proteome; Reference proteome OX=1036808 OS=Scleroderma citrinum Foug A. GN=SCLCIDRAFT_128509 OC=Sclerodermataceae; Scleroderma.
Sequence
MEAPPTPRVCISCGGDGIYRCTDCAHRPVFCTACCRNQHTLQPFHHVQQWNATFFEDSSL
RLVSSILFDDV
Download sequence
Identical sequences A0A0C3DC55
jgi|Sclci1|128509|e_gw1.85.4.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]