SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0C3HYU8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C3HYU8
Domain Number 1 Region: 4-196
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 8.76e-48
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C3HYU8
Sequence length 204
Comment (tr|A0A0C3HYU8|A0A0C3HYU8_9RHOO) Indolepyruvate oxidoreductase subunit iorB {ECO:0000313|EMBL:KIN89947.1} KW=Complete proteome OX=1572758 OS=Thauera sp. SWB20. GN=PO78_1990 OC=Zoogloeaceae; Thauera.
Sequence
MTITNIAVCGIGGQGVMTATEILAEAALSLGFDVKKTEVAGMSQRGGVVTSHLRFGPQVL
SPQIMPGEADLLVGFEAAEALRWAHMLKPGGIALVNQGRFVPPVVTIGLYDYPEDPIGEM
RKLGLAVFDFDASALALQLGNIRLGNTVMLGAMSDRLPFPAEVLRKAVLDRFGARKPELL
ELNRQAFELGRAAVAQPAPAPATA
Download sequence
Identical sequences A0A0C3HYU8
WP_043744409.1.50204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]