SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C3N311 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C3N311
Domain Number 1 Region: 6-119
Classification Level Classification E-value
Superfamily HisI-like 2.22e-49
Family HisI-like 0.000033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C3N311
Sequence length 131
Comment (tr|A0A0C3N311|A0A0C3N311_9RHOO) Phosphoribosyl-AMP cyclohydrolase {ECO:0000256|HAMAP-Rule:MF_01021, ECO:0000256|SAAS:SAAS00976554} KW=Complete proteome OX=1572758 OS=Thauera sp. SWB20. GN=PO78_1917 OC=Zoogloeaceae; Thauera.
Sequence
MSTSTRWLNEIKWDEHGLVPVIAQEAATGDVLMFAWMNREALQRTAETGEAIYWSRSRRK
LWHKGEESGHVQKVLDMRIDCDNDVVLLRIEQVGGIACHTGRHSCFFQKYFADGRWEAVE
PVLKDPQEIYK
Download sequence
Identical sequences A0A0C3N311 N6XV04
WP_004307338.1.50204 WP_004307338.1.88725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]