SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C3NI05 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0C3NI05
Domain Number - Region: 34-70
Classification Level Classification E-value
Superfamily Protein prenylyltransferase 0.0133
Family Protein prenylyltransferase 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C3NI05
Sequence length 101
Comment (tr|A0A0C3NI05|A0A0C3NI05_PISTI) Uncharacterized protein {ECO:0000313|EMBL:KIN95063.1} KW=Complete proteome; Reference proteome OX=870435 OS=Pisolithus tinctorius Marx 270. GN=M404DRAFT_1006541 OC=Pisolithaceae; Pisolithus.
Sequence
MSRIYLDSASNGDVDMGKANLTDRLLGYITRSRGWNVPEAWYYLAKAYGLQGRKEEEREC
LVESFKLIEQRCVRSIGFAVGWCLWAADMCHLWYRATLTYQ
Download sequence
Identical sequences A0A0C3NI05
jgi|Pisti1|1006541|fgenesh1_kg.98_#_24_#_Locus13152v3rpkm1.04 jgi|Pisti1|1007855|fgenesh1_kg.135_#_33_#_Locus13152v3rpkm1.04

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]