SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C3NRU9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0C3NRU9
Domain Number - Region: 51-69
Classification Level Classification E-value
Superfamily Ada DNA repair protein, N-terminal domain (N-Ada 10) 0.0068
Family Ada DNA repair protein, N-terminal domain (N-Ada 10) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C3NRU9
Sequence length 103
Comment (tr|A0A0C3NRU9|A0A0C3NRU9_PISTI) Uncharacterized protein {ECO:0000313|EMBL:KIO03595.1} KW=Complete proteome; Reference proteome OX=870435 OS=Pisolithus tinctorius Marx 270. GN=M404DRAFT_145307 OC=Pisolithaceae; Pisolithus.
Sequence
QTLNDGHKIKHMLMSLEDHKSLVMAPLQADIPWLHQMLSSALKDGASICSILCKIEDALE
HGYRPCNHSDEAYNLALLIYHLGGGNLLYALSHQLALPSLWTL
Download sequence
Identical sequences A0A0C3NRU9
jgi|Pisti1|145307|e_gw1.32.681.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]