SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C3SCK8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C3SCK8
Domain Number 1 Region: 16-70
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.0000000017
Family Transducin (heterotrimeric G protein), gamma chain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C3SCK8
Sequence length 82
Comment (tr|A0A0C3SCK8|A0A0C3SCK8_PHLGI) Uncharacterized protein {ECO:0000313|EMBL:KIP08905.1} KW=Complete proteome; Reference proteome OX=745531 OS=Phlebiopsis gigantea 11061_1 CR5-6. GN=PHLGIDRAFT_23297 OC=Agaricomycetes; Polyporales; Phanerochaetaceae; Phlebiopsis.
Sequence
MNARPHKQSMSELKLRRLAEHNQRLKEDLNRPRIKVSEASASLIRYCKTTKDYLIPSVWG
QVSKAEDPYAPQAAEGCQCVIM
Download sequence
Identical sequences A0A0C3SCK8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]