SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0C4Y2S7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C4Y2S7
Domain Number 1 Region: 749-989
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.1e-27
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.014
Further Details:      
 
Domain Number 2 Region: 28-208
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.00000000000271
Family Pyruvate oxidase and decarboxylase Pyr module 0.051
Further Details:      
 
Domain Number 3 Region: 456-641
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.0000000471
Family PFOR PP module 0.069
Further Details:      
 
Domain Number 4 Region: 282-412
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000011
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C4Y2S7
Sequence length 1189
Comment (tr|A0A0C4Y2S7|A0A0C4Y2S7_9BURK) Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits {ECO:0000313|EMBL:AJG19477.1} KW=Complete proteome; Reference proteome OX=68895 OS=Cupriavidus basilensis. GN=RR42_m2085 OC=Burkholderiaceae; Cupriavidus.
Sequence
MNKRARVEQEIDDTYRLEDRYRREAGSVFLTGTQALVRILVEQARADRIAGLKTGGLVSG
YRGSPLGGFDQELWRQRSLLAEYEIRFEPGLNEDLGATMLWGAQQIDAFPGKRVEGVFSM
WYGKGPGVDRTGDVFRNANVLGTSRHGGVLAIAGDDHAAQSSMFPHQTDHVFEGAMMPVL
FPASVEEYVEFGLFGYALSRFSGLWVAFKAITETVESGRSMLIGGAGSARGARFSLPGDI
DIPERGFGYDTGVKWPGQRAELERRLLEERLPAAQAFARANPIDRTIVRPRDARIGIVTV
GKAHGDLLAALARLGLDEPRLAELGIGLYKIGMTWPIEGEGVRRFASGMRALLVVEEKRS
FVERQIQETLFNVAAPQRPEVFGKRGPNDAPLLPATLEFAPDQLQKALRQFLAYTGVHAL
PPGNTGSAAALPRQPRVIPLSAQLQPDVLTRKPFFCAGCPHNSSTKLPDGSYAAAGIGCH
IMALGQGDNTATFCQMGGEGVQWVGLSSFSDLPHLFVNLGDGTYQHSGSLAIRQAVAAGT
AVTYKILFNDAVAMTGGQPTEGGLTVPRMVAQLIAEGVGKVVLVSDHPQRYWGAKSIPAS
VEIAHRDALDDVQRRLRAYRGVSAIVYDQTCAAEKRRRRKRGTLADPVRRVVINPSVCEG
CGDCSVQSNCIAIEPLETPLGRKRAVNQSSCNKDMSCLKGFCPSFVTIEGLQPKRANQRR
IQQMEAQWRASLPPPAGPAALGALLEHARILVTGVGGTGVVTVGAILAMAAHLEGKGAAT
LDFTGLAQKNGAVVSHVQLADRRERIVTARIEACSADVMIGCDAVVAASPDVLARLRKCG
TRAVVNSAVAPTADFVANGDLPISREIHQAAIESVVGAGQAEFFDCTAAAMTLFGDAIAT
NMMLVGHAYQRGWIPLSEMAIARAIELNGAAVELNRRAFLWGRILACEPNALRRTSAAEA
QAAQPFELARFVAERKRDLSAYQNAAYAERYGRMVAAVAGAEQRIAGEAGLLAEAVARSY
YRVLAYKDEYEVARLHSDPAFARSLESTFDGHGKKTFHMAPPWLTRVDRNTGRRNKIVLS
GTVMSPLLRLLRHGKILRGTPFDPFGRQSDRRIERRMIVECEDDVQLVLRTLSERTLASA
AALVGAYAQIRGFGVIKERNYRSAQADLQKYRALCGAPHAVSGSAEHLT
Download sequence
Identical sequences A0A0C4Y2S7
WP_052494579.1.32789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]