SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C5AMZ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C5AMZ6
Domain Number 1 Region: 4-155
Classification Level Classification E-value
Superfamily N-acetylmuramoyl-L-alanine amidase-like 4.89e-52
Family N-acetylmuramoyl-L-alanine amidase-like 0.00000031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C5AMZ6
Sequence length 223
Comment (tr|A0A0C5AMZ6|A0A0C5AMZ6_9CAUD) N-acetylmuramoyl-L-alanine amidase-like protein {ECO:0000313|EMBL:AJK27685.1} KW=Complete proteome; Reference proteome OX=1589750 OS=Paenibacillus phage Diva. GN=DIVA_21 OC=Sitaravirus.
Sequence
MEIREMLVDPSKYGIKCPNKMAPKYITFHNTYNDAPAENEVRYMIGNNNEVSFHVAVDDK
EAVQGIPFDRNAWHCGDGNGTGNRQSIGVEICYSKSGGNRYYKAEDNAAIIIAQLMKQFC
IPIENVVPHQHWSGKYCPHRMLDEGRVPSFIERIKQAYEGEEDDMSRTLQLEDWQWKQLY
DNMGKVWNAGKFTDWNWMVKIENRCLTVDELAWLNNHILASSL
Download sequence
Identical sequences A0A0C5AC42 A0A0C5AFD4 A0A0C5AMZ6
YP_009197966.1.87368 YP_009203466.1.27085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]