SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C5BR39 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C5BR39
Domain Number 1 Region: 100-186
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 0.000000144
Family Crystallins/Ca-binding development proteins 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C5BR39
Sequence length 188
Comment (tr|A0A0C5BR39|A0A0C5BR39_9MICO) Uncharacterized protein {ECO:0000313|EMBL:KKM46097.1} KW=Complete proteome; Reference proteome OX=145458 OS=Rathayibacter toxicus. GN=VT73_03215 OC=Rathayibacter.
Sequence
MKRSLAVVTATLLIFGAAVITAPAAYASATGGTHNCWQELDTGKSLCVEAGDSLPDAVYA
AYGIVLSTPDRALNVSDQLVSTPAPAQSDVAPVASTVIGIFYENDNYGGAFYITSVAQNG
CNGYAYGYTNLASIGWDDRITSFRSYSNCKTAIFEDTNYGGASYGYYVNSSNVGAAMNDR
ASSIRWAA
Download sequence
Identical sequences A0A0C5BR39
WP_042733824.1.34460 WP_042733824.1.72679 WP_042733824.1.81994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]