SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C5C2F9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0C5C2F9
Domain Number - Region: 115-201
Classification Level Classification E-value
Superfamily Aquaporin-like 0.0589
Family Aquaporin-like 0.03
Further Details:      
 
Domain Number - Region: 90-144
Classification Level Classification E-value
Superfamily Cullin repeat-like 0.0994
Family Exocyst complex component 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C5C2F9
Sequence length 249
Comment (tr|A0A0C5C2F9|A0A0C5C2F9_BACCO) Uncharacterized protein {ECO:0000313|EMBL:AJO20916.1} KW=Complete proteome OX=1398 OS=Bacillus coagulans. GN=CAY57_13695 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MYQNEAQQVMRVCLLAGKIMLMSGAETYRVEDTMSRIAAAAGISGSHSFVTPTAIIFSLD
GAELTKLIRISERSTDLRKVDQVNSISRQISNRGITLKEAYGQLKKIETEEEAYPLWLQF
VAAAISSGCFVIIFLGGWIDFLPACIAGGLGFLSTHYIHRFVKVRFFAEFVASLVIGITA
YILVHAGIGRELDKIIIGSVMPLVPGLAITNALRDLMAGHLFSGVTKGAEAFLTSFAIGS
GIAIILTIF
Download sequence
Identical sequences A0A0C5C2F9 G2TIV1
gi|347751789|ref|YP_004859354.1| WP_014096683.1.2021 WP_014096683.1.23303 WP_014096683.1.29296 WP_014096683.1.31175 WP_014096683.1.3380 WP_014096683.1.33841 WP_014096683.1.40589 WP_014096683.1.42493 WP_014096683.1.65678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]