SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C5DKH2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C5DKH2
Domain Number 1 Region: 2-264
Classification Level Classification E-value
Superfamily Bacterial photosystem II reaction centre, L and M subunits 4.58e-112
Family Bacterial photosystem II reaction centre, L and M subunits 0.000000000483
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C5DKH2
Sequence length 264
Comment (tr|A0A0C5DKH2|A0A0C5DKH2_9VIRU) Protein D1 {ECO:0000313|EMBL:AJO70681.1} OX=215796 OS=uncultured cyanophage. GN=psbA OC=Viruses; unclassified bacterial viruses; environmental samples.
Sequence
VAGSLMYGNNIISGAVVPSSNAIGLHFYPIWEANSLDEWLYNGGPFQLTVFHFLIGIYAY
MGREWELSYRLGMRPWIFVAYSAPVAAATAVFLIYPFGQGSFSDAMPLGTSGTFNYMLVF
QAEHNILMHPFHMLGVAGVFGGSLFSAMHGSPVTSSLVRETTEEVSQNYGYKFGQEEETY
NIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFAALGVSTMAFNLNGFNFNQSL
VSSEGKVINTWADILNRAGLGFEV
Download sequence
Identical sequences A0A0C5DKH2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]