SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C5XEF2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C5XEF2
Domain Number 1 Region: 1-119
Classification Level Classification E-value
Superfamily DsrEFH-like 0.00000000000000286
Family DsrEF-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C5XEF2
Sequence length 121
Comment (tr|A0A0C5XEF2|A0A0C5XEF2_9SPHN) Peroxiredoxin {ECO:0000313|EMBL:AJR22670.1} KW=Complete proteome; Reference proteome OX=484429 OS=Sphingobium sp. YBL2. GN=TZ53_01575 OC=Sphingomonadaceae; Sphingobium.
Sequence
MRELRIIVATADAERLRGALVIAAAQAALGGGAALFLQLDAVSLLRAPPEAPCDEAHRAS
GLPSLAMVIEEALGLGVILLACQSGLALCGMTADDLPQGVEVGGPMGFLQQTGEEARLIF
A
Download sequence
Identical sequences A0A0C5XEF2 A0A2K0XW93
WP_044660207.1.27191 WP_044660207.1.31868 WP_044660207.1.92707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]