SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C6F9W1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C6F9W1
Domain Number 1 Region: 150-210
Classification Level Classification E-value
Superfamily PsbU/PolX domain-like 0.0000000017
Family PsbU-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C6F9W1
Sequence length 211
Comment (tr|A0A0C6F9W1|A0A0C6F9W1_9RHIZ) DNA uptake protein and related DNA-binding proteins {ECO:0000313|EMBL:BAQ43577.1} KW=Complete proteome OX=270351 OS=Methylobacterium aquaticum. GN=Maq22A_c00320 OC=Methylobacteriaceae; Methylobacterium.
Sequence
MLTGSAITRALVIVVLAAGLAGLWQVLMPRATGPHLSEPPKVDAAKVDAAKGDPSRRVES
GRSAAAPATGETADPVRSVYPGPRPAEPSPQRQPPAAEAMPAPAPVPAPAPPVSTPAVPA
PSAAPATMPASTPPPVFSPPSVATAEEPAPAPAGTVDLNTASVAELNGLGGGMIGKAIVA
RRPYASPGELLSKRVLSRATYERIKGQVTVR
Download sequence
Identical sequences A0A0C6F9W1
WP_060845234.1.69189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]