SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C7BNJ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C7BNJ1
Domain Number 1 Region: 16-154
Classification Level Classification E-value
Superfamily MIR domain 5.89e-39
Family MIR domain 0.0000234
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C7BNJ1
Sequence length 205
Comment (tr|A0A0C7BNJ1|A0A0C7BNJ1_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:CEG72984.1} KW=Complete proteome OX=58291 OS=Rhizopus microsporus. GN=RMATCC62417_08453 OC=Rhizopodaceae; Rhizopus.
Sequence
MVNGITLEIILIISKGSGSGQQSVTAFPEANDANSLWLVEAGSGLKCKRGEPVPCGSIIR
LKHVNTRSYLHSHAHQSPLSRQQEVSCYDGQDSGDDWKVECDGQYWTRENVVQLAHQDTS
AYLSSSDRYQFGQPIPGQLEVAAVKGSSKNTQWIAQVSLLFLSLYSFFFNTHIYNIGRYL
FCFHLSNGLCYSQWCRNVFFDFMCI
Download sequence
Identical sequences A0A0C7BNJ1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]