SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C7C8D5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C7C8D5
Domain Number 1 Region: 37-205
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 6.02e-55
Family TRAPP components 0.00000785
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C7C8D5
Sequence length 207
Comment (tr|A0A0C7C8D5|A0A0C7C8D5_9FUNG) Putative Transporter particle subunit trs31 {ECO:0000313|EMBL:CEG79263.1} KW=Complete proteome OX=58291 OS=Rhizopus microsporus. GN=RMATCC62417_13748 OC=Rhizopodaceae; Rhizopus.
Sequence
MSESIPRSSMQSSIYSDNRITRAKSILEKNLNKSRGTEVSLSAQTFLFSEMLQYAQKRVN
GIQDLERKLNEFGYRVGFRMLELLTWREKAAKRETKVLGILYFIHSTVWKALFGKQADSL
EKSTENEDEYMISDNEPILTRYISVPKELSQLNCNAFVAGIVEAVLDGCQFPARVTAHTV
PIDGYPQRTTILIKLDKDVLEREELLK
Download sequence
Identical sequences A0A0C7C8D5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]