SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0C7CJD4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C7CJD4
Domain Number 1 Region: 4-70
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.01e-18
Family Capz alpha-1 subunit 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C7CJD4
Sequence length 81
Comment (tr|A0A0C7CJD4|A0A0C7CJD4_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:CEG82993.1} KW=Complete proteome OX=58291 OS=Rhizopus microsporus. GN=RMATCC62417_16976 OC=Rhizopodaceae; Rhizopus.
Sequence
MSSISVEDKVKIASSFLLSSPPGEVNDVFNDVRTLVNDDEALQDGILQTLEQYNTEQHIT
VRLPDTDYDVCFYYLQAPNLS
Download sequence
Identical sequences A0A0C7CJD4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]