SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0C7NE17 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C7NE17
Domain Number 1 Region: 295-481
Classification Level Classification E-value
Superfamily MIR domain 3.79e-43
Family MIR domain 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C7NE17
Sequence length 664
Comment (tr|A0A0C7NE17|A0A0C7NE17_9SACH) LALA0S12e01750g1_1 {ECO:0000313|EMBL:CEP64562.1} KW=Complete proteome; Reference proteome OX=1245769 OS=Lachancea lanzarotensis. GN=LALA0_S12e01750g OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Lachancea.
Sequence
MSKNAQKREVDLNRGPDRPFLGIEIYEKFFAVKLKGSDYALAVLLAFSFVLRQLRKGGLE
QESRSSELDLLEAARHYNSGNFHINSFPPMIVQVLALSLKFTENLSLETLRKINLVVAGI
TVATFYLTLRASSVVSSVAVAATAVISNLPLFVEESTHLSAEIPQLSFLTCGLLSWNIFK
RSRLGGKKWYFSLLLLAGSIVGGIGTKFLGLVTWAWFLLLLFKRAWETIGDVNIDTVRLF
KFISFGTATIISLPLATFVLSYFVFLSNSRMPSLDHSSMVSPYFENWFLPQPMPQPDVVY
YGSNILIRHAQSIGGYLHSHNYTYPAGSGGQQVSLFLHSNDGDNEWIVEPYSEDLAYREQ
LEPVRNGALIKLRHKNTGKLLRASSAKPPISEQDYDSEVSCTGDWEYKGDADESWRIRFE
RGKPAHHDLLCPYTILFSLENKGHECKLLSHDLRLPEWGFGQQEVLCVDPADKARSLFFV
DRSNLYKERGAYLPRPTDWIGTKLWKVTTEYVQLQYKFDYYLKNNDLISDIKMDSWLWSP
KGSHISSKLMWFAPLACLTIYLIVEIARWARWNPWADPATELDTVKFLYLDVCCELAIGW
FMHYHVFTWCEHENLDPAQYLPSYLLSMVLAAATANFFWQHSKTSRVVLIVYASSVVIAT
YIWA
Download sequence
Identical sequences A0A0C7NE17

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]