SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0C9M4R7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C9M4R7
Domain Number 1 Region: 265-417
Classification Level Classification E-value
Superfamily MIR domain 1.22e-20
Family MIR domain 0.0011
Further Details:      
 
Domain Number 2 Region: 541-628,658-749
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000000000575
Family IP3 receptor type 1 binding core, domain 2 0.0027
Further Details:      
 
Domain Number 3 Region: 138-280
Classification Level Classification E-value
Superfamily MIR domain 0.0000523
Family MIR domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C9M4R7
Sequence length 2599
Comment (tr|A0A0C9M4R7|A0A0C9M4R7_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:GAN04326.1} KW=Complete proteome; Reference proteome OX=91626 OS=Mucor ambiguus. GN=MAM1_0060c03786 OC=Mucoraceae; Mucor.
Sequence
MPVHAATVATAVGAPSTLNLDSDRPHESIFRLGDELFFYDQNNNMLTAENPLETRACVRP
IQPSFLSTHDAMGTSIFRLEPQQSHAAQKELETFVGDDDIESLSCEASVEEVEQLTIVQH
KADKEIAQNEAEKRRLLGKPVVYGQVIQLFNQHFKKYLTVTGKTCYNNKGAQHRLQVNLS
SEFVGYFRIMPRYRIRFVGDVIRVGDTVALQCVRPEGYLNVDYDSSGALNYEVYSHTRLS
SWTMRLHYSSTSDQDTKHVKYTNAGQYVRFYHKEMESYLEAPSIYGNNVVKLKKHIINPL
DPKETESPQAFWEIENVDMSRGSKVRWRSSIRIRHVATRAYLSIDPSNIRIDPATGKTCL
SLKLVKDPPRPFDSSQDSTLFQLVPVSAPPLTGVPYGSFLRIKHTLTDCWMHAASNEDED
TDSTSTSDVPKFTVSDPSSSSLSIHHSKSTGLAPPLLQAPSSFTATKSRHQRFNSTESLF
SNIMDSQQQQPDYFDVDMVNDTLPDLSDDTYFDISAAQDLYYHDCFSITLVDQDLADTFN
YANEMMPPLQRFLCQPRPANQNKSVSFPIQQDEYESIANILKALIQFCTKSNEPDPLKRV
GLPIEYHQVLVRDIGIVKAVIDMIVVPFNLAKRRKVREKLQRQTQQQPSSQDASYNNASS
DEKEVTRSELLLNAQLKHILTLCYHLLRVFLIRRPCTLQEEDDDDSANDGPGRENQLYVF
NNAGEKGIALFIGHLSYNVGATDMLIRLLEVVEQHNVITLPIVTSLIDRAIVRTRDVAEE
LKTGVCVEDTQQRVTCIRLLSALCQKAASPASHRSNKNTAVKADTASLFLLYRERVSEGL
FNRNGKCLLQTKIVEKHVQIQFLNDAWYDLGDLLQQQPRMLLFIESLLDLVYSLSNEPHS
KTSDFMSQCISREVCLSCLKNIALPCALRSKFCDLLRVLYIDVSAFEKVALTDYTIYTQS
INNNTEYYPFGSSGIEAEFFQNLKRWIFRFLDSRHQEFIENSDSIQFLSSVLQLVHTQLR
LGFFQKTRDVSILFRALVHVLDGRTDARNEEHYKYITDVNMPREWRERYVLTEKNMFVMN
TKIQILHIFDLIFDLRLRVRMSKLANLWKVVTENDTAEYHTSPNASGLLLMLSVFEETEL
RDREESLMPILKDILKYQYAPLKEIAIVVMHRLFTDSQELFKEVSNAVVLKDPEQAHVYQ
TIRQQLTLLQRIVYNSRFTDDHCLLHLSQISNIAQELQDIVTVPTDSEGVPIYDESIYCR
IFKSLDACDFLVHVLVSLLNISAKHYHAYVDTINACLNLLCTITSNDKELQTQFVLSNMD
LLISLTELSPKIAVTFARLCSNNLYLSIHIKEGHIIRLLETSEGHQGEYLLVLHDLMKTQ
GKFIKRNQDIVMRFFMDHRQDYVPFDSVEKLKSMHNSDYCINLISILAICGQGENTFGQS
FARTIFSIQDIYDIVYDEHVSIHLKSVMLTFLASIYIEDVELVPEAPIYDNENIAQMFQI
SEDAITRCIYTSSSSAQQQNKDNDFGVFVFGGVLAFLRAMFEYHISIEVAVHEIYRYTHL
VDLVVKLLPLAYQDEKALQANLACLDSMINVAGFRGSMSPRELRDVLKYATKTLDKLNFR
NHHHHHQEQHTTSSSISQLKPIQDTVNISFQKLFQEIKTSQAVKQYQQQEFDRLCSHFSL
VEDIATDIDGSIESLIAYLSTMTTSKVNKRVEHYQVSTIKLLEDVSRKHIRQRIETDPNA
NPSRYEALEKKKVQAQNALNDLGCTLVAQNLLSSPRRRIFDAALKLLISLLDGGNKNVQD
KLEEYFYSIREERFFYSFHQRLQSGISSSKDAQVYLTRKMYKMNRQQHMLDNVLQQQQEK
TYSSTAIRRKKSKSISLVDSNYTTPTVASKRNSYLMLARKRASSIYANLQVPLTTECNDF
YREISQMMAANGETTSESGSTVKDFKVMQDTMRTLQLMVEGHNLHLQMYLTKQPDNIKSF
NIVLDVVEYFHAIVPLCSEQNIELIIQVLDTITELAQGCLQNQVTIFNNKIINPVNTILK
EAYTSCDYQLVNELKSKVVTCLLSLLEGGIENSETIYKEMVESLDLATVKSNMDAIYNQN
LASLNAKNVYEKLECGFLYAILVMTLAPAIKDQEQSAMFFERNDAFDYFQSHTGKIEILM
DYGQEKQLTRVLFPVPEVCQYLRQETKQRFLWNVKRIENQAHVAHSKYLSFLTEYSTFWW
ESAYAVSILLNVLLMLYPNLLVDAANTDSSHQRPFLIMCYRYLLGLAHLGLWLLLTTEFY
FIQLPVLINRRHGLHVRTFIWARTLTDSKFLYHILMVVFSAIGLVYPGFYSLHLLDFVFR
DSILQGVISSITLNVHSISRTAILGIIVIYIHSIVAYMYFRKEFDVAKGLFCGSLMECFV
TVLSHGVRSGGGIGDILEPDEFHKPSGWRTMFEMSFYLVVVVFLLNAIFGIIFDTFGHLR
DERSSIQQDMKNSCFICSIPAVEFQRHAKKGFEDHIKNDHNIWQYLFFLVHLRNKDRTEY
TGPESYVAGCLKNADYSFFPINRALGLATDEQDDTERLDRLEEMNQQLLDKLAKLEEHLD
KLTDHQIRSRQNSFMLSPM
Download sequence
Identical sequences A0A0C9M4R7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]