SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C9N8E9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C9N8E9
Domain Number 1 Region: 3-188
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 1.05e-41
Family Ran-binding protein mog1p 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C9N8E9
Sequence length 188
Comment (tr|A0A0C9N8E9|A0A0C9N8E9_9FUNG) Ran GTPase binding protein {ECO:0000313|EMBL:GAN10923.1} KW=Complete proteome; Reference proteome OX=91626 OS=Mucor ambiguus. GN=MAM1_0430d10473 OC=Mucoraceae; Mucor.
Sequence
MDTQELFGGAIVVPVLGSFVDASQFRQIPDNQEVFVDMNTQQSLIFELLEKVEAMDEQVA
RYHFQQLADDNEAAESTVTMVDSLKPQDISPLLPQDATEIYVLQGSQKIAKFNESNAFNT
VEIILVVVRLTKVETDFVISVNAPVKLASASSEQESVNETSAVTIDTVKQEMLTILKGLQ
VKDWSLFG
Download sequence
Identical sequences A0A0C9N8E9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]